PRPH Blocking Peptide (33R-7897)
A synthetic peptide for use as a blocking control in assays to test for specificity of PRPH antibody, catalog no. 70R-2612
Overview
Overview
| Synonyms | PRPH control peptide, PRPH antibody Blocking Peptide, Anti-PRPH Blocking Peptide, Peripherin Blocking Peptide, NEF4 Blocking Peptide, PRPH1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product