PRPH Blocking Peptide (33R-7897)

A synthetic peptide for use as a blocking control in assays to test for specificity of PRPH antibody, catalog no. 70R-2612

Synonyms PRPH control peptide, PRPH antibody Blocking Peptide, Anti-PRPH Blocking Peptide, Peripherin Blocking Peptide, NEF4 Blocking Peptide, PRPH1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors