PRPS2 antibody (70R-1255)

Rabbit polyclonal PRPS2 antibody raised against the N terminal of PRPS2

Synonyms Polyclonal PRPS2 antibody, Anti-PRPS2 antibody, PRPS 2 antibody, PRPS2, PRPS-2 antibody, PRPS 2, Phosphoribosyl Pyrophosphate Synthetase 2 antibody, PRSII antibody, PRPS-2, PRS II antibody
Specificity PRPS2 antibody was raised against the N terminal of PRPS2
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG
Assay Information PRPS2 Blocking Peptide, catalog no. 33R-6299, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody


Western Blot analysis using PRPS2 antibody (70R-1255)

PRPS2 antibody (70R-1255) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRPS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRPS2 antibody (70R-1255) | PRPS2 antibody (70R-1255) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors