PRPS2 antibody (70R-1270)

Rabbit polyclonal PRPS2 antibody raised against the middle region of PRPS2

Synonyms Polyclonal PRPS2 antibody, Anti-PRPS2 antibody, PRSII antibody, PRPS2, PRPS-2 antibody, Phosphoribosyl Pyrophosphate Synthetase 2 antibody, PRPS-2, PRPS 2, PRPS 2 antibody, PRS II antibody
Specificity PRPS2 antibody was raised against the middle region of PRPS2
Cross Reactivity Human,Mouse,Rat,Dog,Drosophila
Applications WB
Immunogen PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV
Assay Information PRPS2 Blocking Peptide, catalog no. 33R-2608, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody


Western Blot analysis using PRPS2 antibody (70R-1270)

PRPS2 antibody (70R-1270) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRPS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The PRPS2 protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRPS2 antibody (70R-1270) | PRPS2 antibody (70R-1270) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors