PRPSAP2 antibody (70R-3195)

Rabbit polyclonal PRPSAP2 antibody raised against the N terminal of PRPSAP2

Synonyms Polyclonal PRPSAP2 antibody, Anti-PRPSAP2 antibody, PRPSAP-2, MGC126719 antibody, MGC117304 antibody, Phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 antibody, PAP41 antibody, MGC126721 antibody, PRPSAP2, PRPSAP-2 antibody, PRPSAP 2 antibody, PRPSAP 2
Specificity PRPSAP2 antibody was raised against the N terminal of PRPSAP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRPSAP2 antibody was raised using the N terminal of PRPSAP2 corresponding to a region with amino acids MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ
Assay Information PRPSAP2 Blocking Peptide, catalog no. 33R-5987, is also available for use as a blocking control in assays to test for specificity of this PRPSAP2 antibody


Western Blot analysis using PRPSAP2 antibody (70R-3195)

PRPSAP2 antibody (70R-3195) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRPSAP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRPSAP2 antibody (70R-3195) | PRPSAP2 antibody (70R-3195) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors