PRR11 antibody (70R-3162)

Rabbit polyclonal PRR11 antibody raised against the middle region of PRR11

Synonyms Polyclonal PRR11 antibody, Anti-PRR11 antibody, Proline Rich 11 antibody, PRR11, PRR 11, PRR 11 antibody, FLJ11029 antibody, PRR-11, PRR-11 antibody
Specificity PRR11 antibody was raised against the middle region of PRR11
Cross Reactivity Human
Applications WB
Immunogen PRR11 antibody was raised using the middle region of PRR11 corresponding to a region with amino acids PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF
Assay Information PRR11 Blocking Peptide, catalog no. 33R-7112, is also available for use as a blocking control in assays to test for specificity of this PRR11 antibody


Western Blot analysis using PRR11 antibody (70R-3162)

PRR11 antibody (70R-3162) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRR11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the PRR11 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRR11 antibody (70R-3162) | PRR11 antibody (70R-3162) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors