PRR13 Blocking Peptide (33R-6618)

A synthetic peptide for use as a blocking control in assays to test for specificity of PRR13 antibody, catalog no. 70R-3720

Synonyms PRR13 control peptide, PRR13 antibody Blocking Peptide, Anti-PRR13 Blocking Peptide, Proline Rich 13 Blocking Peptide, DKFZp564J157 Blocking Peptide, FLJ23818 Blocking Peptide, TXR1 Blocking Peptide, PRR13, PRR-13, PRR 13, PRR-13 Blocking Peptide, PRR 13 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG
Molecular Weight 15 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors