PRR13 Blocking Peptide (33R-6618)
A synthetic peptide for use as a blocking control in assays to test for specificity of PRR13 antibody, catalog no. 70R-3720
Overview
Overview
| Synonyms | PRR13 control peptide, PRR13 antibody Blocking Peptide, Anti-PRR13 Blocking Peptide, Proline Rich 13 Blocking Peptide, DKFZp564J157 Blocking Peptide, FLJ23818 Blocking Peptide, TXR1 Blocking Peptide, PRR13, PRR-13, PRR 13, PRR-13 Blocking Peptide, PRR 13 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG |
|---|---|
| Molecular Weight | 15 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product