PRR18 Blocking Peptide (33R-8101)
A synthetic peptide for use as a blocking control in assays to test for specificity of PRR18 antibody, catalog no. 70R-4397
Overview
Overview
| Synonyms | PRR18 control peptide, PRR18 antibody Blocking Peptide, Anti-PRR18 Blocking Peptide, Proline Rich Region 18 Blocking Peptide, MGC35308 Blocking Peptide, PRR18, PRR-18, PRR 18, PRR-18 Blocking Peptide, PRR 18 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of PRR18 has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product