PRR5 Blocking Peptide (33R-6877)
A synthetic peptide for use as a blocking control in assays to test for specificity of PRR5 antibody, catalog no. 70R-9436
Overview
Overview
| Synonyms | PRR5 control peptide, PRR5 antibody Blocking Peptide, Anti-PRR5 Blocking Peptide, proline rich 5, renal Blocking Peptide, FLJ20185 Blocking Peptide, FLJ20185k Blocking Peptide, PP610 Blocking Peptide, PROTOR1 Blocking Peptide, PRR5, PRR-5, PRR 5, PRR-5 Blocking Peptide, PRR 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product