PRR5 Blocking Peptide (33R-6877)

A synthetic peptide for use as a blocking control in assays to test for specificity of PRR5 antibody, catalog no. 70R-9436

Synonyms PRR5 control peptide, PRR5 antibody Blocking Peptide, Anti-PRR5 Blocking Peptide, proline rich 5, renal Blocking Peptide, FLJ20185 Blocking Peptide, FLJ20185k Blocking Peptide, PP610 Blocking Peptide, PROTOR1 Blocking Peptide, PRR5, PRR-5, PRR 5, PRR-5 Blocking Peptide, PRR 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors