PRSS22 antibody (70R-3993)

Rabbit polyclonal PRSS22 antibody raised against the N terminal of PRSS22

Synonyms Polyclonal PRSS22 antibody, Anti-PRSS22 antibody, MGC9599 antibody, PRSS-22 antibody, BSSP-4 antibody, Protease Serine 22 antibody, PRSS22, PRSS 22, PRSS 22 antibody, SP001LA antibody, hBSSP-4 antibody, PRSS-22
Specificity PRSS22 antibody was raised against the N terminal of PRSS22
Cross Reactivity Human
Applications WB
Immunogen PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW
Assay Information PRSS22 Blocking Peptide, catalog no. 33R-4104, is also available for use as a blocking control in assays to test for specificity of this PRSS22 antibody


Western Blot analysis using PRSS22 antibody (70R-3993)

PRSS22 antibody (70R-3993) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRSS22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRSS22 antibody (70R-3993) | PRSS22 antibody (70R-3993) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors