PSAT1 antibody (70R-3185)

Rabbit polyclonal PSAT1 antibody raised against the N terminal of PSAT1

Synonyms Polyclonal PSAT1 antibody, Anti-PSAT1 antibody, PSAT antibody, PSAT 1, PSA antibody, Phosphoserine Aminotransferase 1 antibody, PSAT-1 antibody, EPIP antibody, PSAT-1, PSAT1, MGC1460 antibody, PSAT 1 antibody
Specificity PSAT1 antibody was raised against the N terminal of PSAT1
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
Assay Information PSAT1 Blocking Peptide, catalog no. 33R-1111, is also available for use as a blocking control in assays to test for specificity of this PSAT1 antibody


Immunohistochemical staining using PSAT1 antibody (70R-3185)

PSAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSAT1 is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PSAT1 antibody (70R-3185) | PSAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PSAT1 antibody (70R-3185) | PSAT1 antibody (70R-3185) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using PSAT1 antibody (70R-3185) | PSAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors