PSG1 antibody (70R-1590)

Rabbit polyclonal PSG1 antibody raised against the C terminal of PSG1

Synonyms Polyclonal PSG1 antibody, Anti-PSG1 antibody, FLJ90654 antibody, PSGIIA-c antibody, SP1 antibody, PSBG1 antibody, DHFRP2 antibody, PSG 1 antibody, Pregnancy Specific Beta-1-Glycoprotein 1 antibody, PSGGA antibody, FLJ90598 antibody, B1G1 antibody, PSG-1 antibody, PSG IIA-d antibody, CD66f antibody, PSG-1, PSGIIA-b antibody, PSG1, PBG1 antibody, PSG 1, PSGIIA-a antibody
Specificity PSG1 antibody was raised against the C terminal of PSG1
Cross Reactivity Human
Applications WB
Immunogen PSG1 antibody was raised using the C terminal of PSG1 corresponding to a region with amino acids YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
Assay Information PSG1 Blocking Peptide, catalog no. 33R-10182, is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody


Western Blot analysis using PSG1 antibody (70R-1590)

PSG1 antibody (70R-1590) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSG1 plays an immunomodulatory roles during pregnancy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSG1 antibody (70R-1590) | PSG1 antibody (70R-1590) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors