PSG3 antibody (70R-1279)

Rabbit polyclonal PSG3 antibody raised against the N terminal of PSG3

Synonyms Polyclonal PSG3 antibody, Anti-PSG3 antibody, PSG 3, PSG-3 antibody, PSG-3, Pregnancy Specific Beta-1-Glycoprotein 3 antibody, PSG3, PSG 3 antibody
Specificity PSG3 antibody was raised against the N terminal of PSG3
Cross Reactivity Human
Applications IHC, WB
Immunogen PSG3 antibody was raised using the N terminal of PSG3 corresponding to a region with amino acids VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS
Assay Information PSG3 Blocking Peptide, catalog no. 33R-9927, is also available for use as a blocking control in assays to test for specificity of this PSG3 antibody

Images

Immunohistochemical staining using PSG3 antibody (70R-1279)

PSG3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSG3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PSG3 antibody (70R-1279) | PSG3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PSG3 antibody (70R-1279) | PSG3 antibody (70R-1279) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors