PSG5 antibody (70R-1582)

Rabbit polyclonal PSG5 antibody raised against the N terminal of PSG5

Synonyms Polyclonal PSG5 antibody, Anti-PSG5 antibody, PSG5, Pregnancy Specific Beta-1-Glycoprotein 5 antibody, PSG-5, PSG antibody, PSG-5 antibody, FL-NCA-3 antibody, PSG 5 antibody, PSG 5
Specificity PSG5 antibody was raised against the N terminal of PSG5
Cross Reactivity Human
Applications WB
Immunogen PSG5 antibody was raised using the N terminal of PSG5 corresponding to a region with amino acids QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY
Assay Information PSG5 Blocking Peptide, catalog no. 33R-7634, is also available for use as a blocking control in assays to test for specificity of this PSG5 antibody

Images

Western Blot analysis using PSG5 antibody (70R-1582)

PSG5 antibody (70R-1582) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSG5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSG5 antibody (70R-1582) | PSG5 antibody (70R-1582) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors