PSMA2 antibody (70R-2393)
Rabbit polyclonal PSMA2 antibody
Overview
Overview
Synonyms | Polyclonal PSMA2 antibody, Anti-PSMA2 antibody, PSMA 2, PSMA 2 antibody, PSC2 antibody, Proteasome macropain subunit alpha type 2 antibody, PSMA-2, HC3 antibody, PSMA2, Prosome Macropain Subunit Alpha Type 2 antibody, PMSA2 antibody, MU antibody, PSMA-2 antibody |
---|---|
Cross Reactivity | Human,Mouse,Rat |
Applications | WB |
Immunogen | PSMA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
Assay Information | PSMA2 Blocking Peptide, catalog no. 33R-9560, is also available for use as a blocking control in assays to test for specificity of this PSMA2 antibody |
Images
Western Blot analysis using PSMA2 antibody (70R-2393)
PSMA2 antibody (70R-2393) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 26 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMA2 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product