PSMB1 Blocking Peptide (33R-6806)
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB1 antibody, catalog no. 70R-2340
Overview
Overview
| Synonyms | PSMB1 control peptide, PSMB1 antibody Blocking Peptide, Anti-PSMB1 Blocking Peptide, Proteasome macropain subunit beta type 1 Blocking Peptide, Prosome Macropain Subunit Beta Type 1 Blocking Peptide, FLJ25321 Blocking Peptide, HC5 Blocking Peptide, KIAA1838 Blocking Peptide, PMSB1 Blocking Peptide, PSC5 Blocking Peptide, PSMB1, PSMB-1, PSMB 1, PSMB-1 Blocking Peptide, PSMB 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB1 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product