PSMB1 Blocking Peptide (33R-6806)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB1 antibody, catalog no. 70R-2340

Synonyms PSMB1 control peptide, PSMB1 antibody Blocking Peptide, Anti-PSMB1 Blocking Peptide, Proteasome macropain subunit beta type 1 Blocking Peptide, Prosome Macropain Subunit Beta Type 1 Blocking Peptide, FLJ25321 Blocking Peptide, HC5 Blocking Peptide, KIAA1838 Blocking Peptide, PMSB1 Blocking Peptide, PSC5 Blocking Peptide, PSMB1, PSMB-1, PSMB 1, PSMB-1 Blocking Peptide, PSMB 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB1 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors