PSMB10 antibody (70R-5872)

Rabbit polyclonal PSMB10 antibody

Synonyms Polyclonal PSMB10 antibody, Anti-PSMB10 antibody, PSMB-10 antibody, PSMB 10, Prosome Macropain Subunit Beta Type 10 antibody, LMP10 antibody, PSMB 10 antibody, MGC1665 antibody, Proteasome macropain subunit beta type 10 antibody, PSMB-10, MECL1 antibody, PSMB10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG
Assay Information PSMB10 Blocking Peptide, catalog no. 33R-2068, is also available for use as a blocking control in assays to test for specificity of this PSMB10 antibody

Images

Western Blot analysis using PSMB10 antibody (70R-5872)

PSMB10 antibody (70R-5872) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSMB10 antibody (70R-5872) | PSMB10 antibody (70R-5872) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors