PSMB2 antibody (70R-2346)

Rabbit polyclonal PSMB2 antibody

Synonyms Polyclonal PSMB2 antibody, Anti-PSMB2 antibody, HC7-I antibody, PSMB 2 antibody, PSMB-2 antibody, PSMB2, Proteasome macropain subunit beta type 2 antibody, PSMB 2, PSMB-2, MGC104215 antibody, Prosome Macropain Subunit Beta Type 2 antibody, MGC126885 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA
Assay Information PSMB2 Blocking Peptide, catalog no. 33R-10064, is also available for use as a blocking control in assays to test for specificity of this PSMB2 antibody


Western Blot analysis using PSMB2 antibody (70R-2346)

PSMB2 antibody (70R-2346) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMB2 antibody (70R-2346) | PSMB2 antibody (70R-2346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors