PSMB6 antibody (70R-3524)

Rabbit polyclonal PSMB6 antibody

Synonyms Polyclonal PSMB6 antibody, Anti-PSMB6 antibody, DELTA antibody, PSMB 6, Proteasome macropain subunit beta type 6 antibody, PSMB-6 antibody, PSMB 6 antibody, PSMB6, Prosome Macropain Subunit Beta Type 6 antibody, MGC5169 antibody, PSMB-6, LMPY antibody, Y antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA
Assay Information PSMB6 Blocking Peptide, catalog no. 33R-9319, is also available for use as a blocking control in assays to test for specificity of this PSMB6 antibody


Western Blot analysis using PSMB6 antibody (70R-3524)

PSMB6 antibody (70R-3524) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMB6 antibody (70R-3524) | PSMB6 antibody (70R-3524) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors