PSMB9 antibody (70R-5740)

Rabbit polyclonal PSMB9 antibody raised against the C terminal of PSMB9

Synonyms Polyclonal PSMB9 antibody, Anti-PSMB9 antibody, Proteasome macropain subunit beta type 9, LMP2 antibody, RING12 antibody, MGC70470 antibody, PSMB 9, Prosome Macropain Subunit Beta Type 9 antibody, PSMB-9, PSMB 9 antibody, PSMB9, PSMB-9 antibody
Specificity PSMB9 antibody was raised against the C terminal of PSMB9
Cross Reactivity Human
Applications WB
Immunogen PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Assay Information PSMB9 Blocking Peptide, catalog no. 33R-8138, is also available for use as a blocking control in assays to test for specificity of this PSMB9 antibody

Images

Western Blot analysis using PSMB9 antibody (70R-5740)

PSMB9 antibody (70R-5740) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSMB9 antibody (70R-5740) | PSMB9 antibody (70R-5740) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors