PSMB9 Blocking Peptide (33R-8138)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB9 antibody, catalog no. 70R-5740

Synonyms PSMB9 control peptide, PSMB9 antibody Blocking Peptide, Anti-PSMB9 Blocking Peptide, Proteasome macropain subunit beta type 9, Prosome Macropain Subunit Beta Type 9 Blocking Peptide, LMP2 Blocking Peptide, MGC70470 Blocking Peptide, RING12 Blocking Peptide, PSMB9, PSMB-9, PSMB 9, PSMB-9 Blocking Peptide, PSMB 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors