PSMC3IP Blocking Peptide (33R-8034)
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC3IP antibody, catalog no. 20R-1263
Overview
Overview
| Synonyms | PSMC3IP control peptide, PSMC3IP antibody Blocking Peptide, Anti-PSMC3IP Blocking Peptide, PSMC3 interacting protein Blocking Peptide, GT198 Blocking Peptide, HOP2 Blocking Peptide, TBPIP Blocking Peptide, PSMC3IP, PSMCIP-3, PSMCIP 3, PSMCIP-3 Blocking Peptide, PSMCIP 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP |
|---|---|
| Molecular Weight | 25 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product