PSMC3IP Blocking Peptide (33R-8034)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC3IP antibody, catalog no. 20R-1263

Synonyms PSMC3IP control peptide, PSMC3IP antibody Blocking Peptide, Anti-PSMC3IP Blocking Peptide, PSMC3 interacting protein Blocking Peptide, GT198 Blocking Peptide, HOP2 Blocking Peptide, TBPIP Blocking Peptide, PSMC3IP, PSMCIP-3, PSMCIP 3, PSMCIP-3 Blocking Peptide, PSMCIP 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP
Molecular Weight 25 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors