PSMD3 Blocking Peptide (33R-8042)
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMD3 antibody, catalog no. 70R-4327
Overview
Overview
| Synonyms | PSMD3 control peptide, PSMD3 antibody Blocking Peptide, Anti-PSMD3 Blocking Peptide, Proteasome macropain 26S subunit non-ATPase 3 Blocking Peptide, Prosome Macropain 26S Subunit Non-Atpase 3 Blocking Peptide, P58 Blocking Peptide, RPN3 Blocking Peptide, S3 Blocking Peptide, PSMD3, PSMD-3, PSMD 3, PSMD-3 Blocking Peptide, PSMD 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product