PSMD3 Blocking Peptide (33R-8042)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMD3 antibody, catalog no. 70R-4327

Synonyms PSMD3 control peptide, PSMD3 antibody Blocking Peptide, Anti-PSMD3 Blocking Peptide, Proteasome macropain 26S subunit non-ATPase 3 Blocking Peptide, Prosome Macropain 26S Subunit Non-Atpase 3 Blocking Peptide, P58 Blocking Peptide, RPN3 Blocking Peptide, S3 Blocking Peptide, PSMD3, PSMD-3, PSMD 3, PSMD-3 Blocking Peptide, PSMD 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors