PSME2 Blocking Peptide (33R-8551)

A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9402

Synonyms PSME2 control peptide, PSME2 antibody Blocking Peptide, Anti-PSME2 Blocking Peptide, proteasome, prosome, macropain activator subunit 2, PA28 beta Blocking Peptide, PA28B Blocking Peptide, PA28beta Blocking Peptide, REGbeta Blocking Peptide, PSME2, PSME-2, PSME 2, PSME-2 Blocking Peptide, PSME 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors