PSME2 Blocking Peptide (33R-8551)
A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9402
Overview
Overview
| Synonyms | PSME2 control peptide, PSME2 antibody Blocking Peptide, Anti-PSME2 Blocking Peptide, proteasome, prosome, macropain activator subunit 2, PA28 beta Blocking Peptide, PA28B Blocking Peptide, PA28beta Blocking Peptide, REGbeta Blocking Peptide, PSME2, PSME-2, PSME 2, PSME-2 Blocking Peptide, PSME 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV |
|---|---|
| Molecular Weight | 27 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product