PTGDS antibody (70R-5341)

Rabbit polyclonal PTGDS antibody

Synonyms Polyclonal PTGDS antibody, Anti-PTGDS antibody, PGDS2 antibody, PGD2 antibody, PDS antibody, Prostaglandin D2 Synthase 21Kda antibody, PGDS antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen PTGDS antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS
Assay Information PTGDS Blocking Peptide, catalog no. 33R-5773, is also available for use as a blocking control in assays to test for specificity of this PTGDS antibody

Images

Immunohistochemical staining using PTGDS antibody (70R-5341)

PTGDS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTGDS is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PTGDS antibody (70R-5341) | PTGDS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PTGDS antibody (70R-5341) | PTGDS antibody (70R-5341) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using PTGDS antibody (70R-5341) | PTGDS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors