PTGS1 antibody (70R-1882)

Rabbit polyclonal PTGS1 antibody

Synonyms Polyclonal PTGS1 antibody, Anti-PTGS1 antibody, PTGS1, COX1 antibody, Prostaglandin G/H Synthase And Cyclooxygenase antibody, Prostaglandin-Endoperoxide Synthase 1 antibody, PGHS-1 antibody, COX3 antibody, PTGS-1, PCOX1 antibody, PGHS1 antibody, PTGS 1 antibody, PGG/HS antibody, PTGS 1, PTGS-1 antibody, PTGHS antibody, PHS1 antibody
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen PTGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWE
Assay Information PTGS1 Blocking Peptide, catalog no. 33R-4863, is also available for use as a blocking control in assays to test for specificity of this PTGS1 antibody

Images

Immunohistochemical staining using PTGS1 antibody (70R-1882)

PTGS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTGS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PTGS1 antibody (70R-1882) | PTGS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PTGS1 antibody (70R-1882) | PTGS1 antibody (70R-1882) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors