PTHLH Blocking Peptide (33R-10147)
A synthetic peptide for use as a blocking control in assays to test for specificity of PTHLH antibody, catalog no. 70R-1717
Overview
Overview
| Synonyms | PTHLH control peptide, PTHLH antibody Blocking Peptide, Anti-PTHLH Blocking Peptide, Parathyroid Hormone-Like Hormone Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product