PTK2B antibody (70R-1706)

Rabbit polyclonal PTK2B antibody raised against the C terminal of PTK2B

Synonyms Polyclonal PTK2B antibody, Anti-PTK2B antibody, PTK-2 antibody, Ptk2B Protein Tyrosine Kinase 2 Beta antibody, PTK-2, PTK 2, PTK 2 antibody, PTK2
Specificity PTK2B antibody was raised against the C terminal of PTK2B
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR
Assay Information PTK2B Blocking Peptide, catalog no. 33R-7611, is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody


Western blot analysis using PTK2B antibody (70R-1706)

Recommended PTK2B Antibody Titration: 1.25ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 116 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTK2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PTK2B antibody (70R-1706) | Recommended PTK2B Antibody Titration: 1.25ug/ml

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors