PTP4A3 antibody (70R-2657)

Rabbit polyclonal PTP4A3 antibody raised against the middle region of PTP4A3

Synonyms Polyclonal PTP4A3 antibody, Anti-PTP4A3 antibody, PTPA3-4 antibody, PTPA3 4 antibody, PRL-R antibody, PRL3 antibody, PRL-3 antibody, PTP4A3, PTPA3 4, Protein Tyrosine Phosphatase Type Iva Member 3 antibody, PTPA3-4
Specificity PTP4A3 antibody was raised against the middle region of PTP4A3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTP4A3 antibody was raised using the middle region of PTP4A3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR
Assay Information PTP4A3 Blocking Peptide, catalog no. 33R-4993, is also available for use as a blocking control in assays to test for specificity of this PTP4A3 antibody

Western Blot analysis using PTP4A3 antibody (70R-2657)

PTP4A3 antibody (70R-2657) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTP4A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTP4A3 belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contains a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PTP4A3 antibody (70R-2657) | PTP4A3 antibody (70R-2657) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors