PTPN2 antibody (70R-1839)

Rabbit polyclonal PTPN2 antibody raised against the N terminal of PTPN2

Synonyms Polyclonal PTPN2 antibody, Anti-PTPN2 antibody, TC-PTP antibody, PTPN 2, Protein Tyrosine Phosphatase Non-Receptor Type 2 antibody, PTPN2, PTPN-2 antibody, TCPTP antibody, PTPN 2 antibody, PTPT antibody, PTPN-2, TCELLPTP antibody
Specificity PTPN2 antibody was raised against the N terminal of PTPN2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS
Assay Information PTPN2 Blocking Peptide, catalog no. 33R-4905, is also available for use as a blocking control in assays to test for specificity of this PTPN2 antibody

Images

Western Blot analysis using PTPN2 antibody (70R-1839)

PTPN2 antibody (70R-1839) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTPN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTPN2 antibody (70R-1839) | PTPN2 antibody (70R-1839) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors