PTRH2 Blocking Peptide (33R-8080)

A synthetic peptide for use as a blocking control in assays to test for specificity of PTRH2 antibody, catalog no. 70R-1785

Synonyms PTRH2 control peptide, PTRH2 antibody Blocking Peptide, Anti-PTRH2 Blocking Peptide, Peptidyl-tRNA Hydrolase 2 Blocking Peptide, BIT1 Blocking Peptide, CGI-147 Blocking Peptide, FLJ32471 Blocking Peptide, PTH2 Blocking Peptide, PTRH2, PTRH-2, PTRH 2, PTRH-2 Blocking Peptide, PTRH 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors