PTRH2 Blocking Peptide (33R-8080)
A synthetic peptide for use as a blocking control in assays to test for specificity of PTRH2 antibody, catalog no. 70R-1785
Overview
Overview
| Synonyms | PTRH2 control peptide, PTRH2 antibody Blocking Peptide, Anti-PTRH2 Blocking Peptide, Peptidyl-tRNA Hydrolase 2 Blocking Peptide, BIT1 Blocking Peptide, CGI-147 Blocking Peptide, FLJ32471 Blocking Peptide, PTH2 Blocking Peptide, PTRH2, PTRH-2, PTRH 2, PTRH-2 Blocking Peptide, PTRH 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product