PUF60 antibody (70R-1437)

Rabbit polyclonal PUF60 antibody raised against the C terminal of PUF60

Synonyms Polyclonal PUF60 antibody, Anti-PUF60 antibody, FIR antibody, PUF 60, SIAHBP1 antibody, PUF-60 antibody, PUF60, PUF 60 antibody, Poly-U Binding Splicing Factor 60Kda antibody, FLJ31379 antibody, RoBPI antibody, PUF-60
Specificity PUF60 antibody was raised against the C terminal of PUF60
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA


Immunohistochemical staining using PUF60 antibody (70R-1437)

PUF60 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PUF60 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PUF60 antibody (70R-1437) | PUF60 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PUF60 antibody (70R-1437) | PUF60 antibody (70R-1437) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using PUF60 antibody (70R-1437) | PUF60 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors