PVRL3 Blocking Peptide (33R-7025)

A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6424

Synonyms PVRL3 control peptide, PVRL3 antibody Blocking Peptide, Anti-PVRL3 Blocking Peptide, Poliovirus Receptor-Related 3 Blocking Peptide, CDw113 Blocking Peptide, DKFZP566B0846 Blocking Peptide, FLJ90624 Blocking Peptide, PPR3 Blocking Peptide, PRR3 Blocking Peptide, PVRR3 Blocking Peptide, nectin-3 Blocking Peptide, PVRL3, PVRL-3, PVRL 3, PVRL-3 Blocking Peptide, PVRL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors