PVRL3 Blocking Peptide (33R-7025)
A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6424
Overview
Overview
| Synonyms | PVRL3 control peptide, PVRL3 antibody Blocking Peptide, Anti-PVRL3 Blocking Peptide, Poliovirus Receptor-Related 3 Blocking Peptide, CDw113 Blocking Peptide, DKFZP566B0846 Blocking Peptide, FLJ90624 Blocking Peptide, PPR3 Blocking Peptide, PRR3 Blocking Peptide, PVRR3 Blocking Peptide, nectin-3 Blocking Peptide, PVRL3, PVRL-3, PVRL 3, PVRL-3 Blocking Peptide, PVRL 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product