Pxmp3 Blocking Peptide (33R-6343)

A synthetic peptide for use as a blocking control in assays to test for specificity of Pxmp3 antibody, catalog no. 70R-8552

Synonyms Pxmp3 control peptide, Pxmp3 antibody Blocking Peptide, Anti-Pxmp3 Blocking Peptide, peroxisomal membrane protein 3 Blocking Peptide, 35kDa Blocking Peptide, D3Ertd138e Blocking Peptide, PMP35 Blocking Peptide, Pex2 Blocking Peptide, Pxmp3, Pxmp-3, Pxmp 3, Pxmp-3 Blocking Peptide, Pxmp 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pxmp3 is somewhat implicated in the biogenesis of peroxisomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors