Pxmp3 Blocking Peptide (33R-6343)
A synthetic peptide for use as a blocking control in assays to test for specificity of Pxmp3 antibody, catalog no. 70R-8552
Overview
Overview
| Synonyms | Pxmp3 control peptide, Pxmp3 antibody Blocking Peptide, Anti-Pxmp3 Blocking Peptide, peroxisomal membrane protein 3 Blocking Peptide, 35kDa Blocking Peptide, D3Ertd138e Blocking Peptide, PMP35 Blocking Peptide, Pex2 Blocking Peptide, Pxmp3, Pxmp-3, Pxmp 3, Pxmp-3 Blocking Peptide, Pxmp 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Pxmp3 is somewhat implicated in the biogenesis of peroxisomes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product