PYCR2 antibody (70R-3314)

Rabbit polyclonal PYCR2 antibody raised against the C terminal of PYCR2

Synonyms Polyclonal PYCR2 antibody, Anti-PYCR2 antibody, PYCR 2 antibody, PYCR2, PYCR 2, PYCR-2 antibody, PYCR-2, P5CR2 antibody, Pyrroline-5-Carboxylate Reductase Family Member 2 antibody
Specificity PYCR2 antibody was raised against the C terminal of PYCR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Assay Information PYCR2 Blocking Peptide, catalog no. 33R-5055, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Images

Western Blot analysis using PYCR2 antibody (70R-3314)

PYCR2 antibody (70R-3314) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PYCR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PYCR2 antibody (70R-3314) | PYCR2 antibody (70R-3314) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors