PYCR2 antibody (70R-3755)

Rabbit polyclonal PYCR2 antibody raised against the middle region of PYCR2

Synonyms Polyclonal PYCR2 antibody, Anti-PYCR2 antibody, PYCR 2 antibody, PYCR-2, PYCR 2, Pyrroline-5-Carboxylate Reductase Family Member 2 antibody, PYCR-2 antibody, PYCR2, P5CR2 antibody
Specificity PYCR2 antibody was raised against the middle region of PYCR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE
Assay Information PYCR2 Blocking Peptide, catalog no. 33R-4866, is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Images

Western Blot analysis using PYCR2 antibody (70R-3755)

PYCR2 antibody (70R-3755) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PYCR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PYCR2 antibody (70R-3755) | PYCR2 antibody (70R-3755) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors