PYGB antibody (70R-2604)

Rabbit polyclonal PYGB antibody raised against the N terminal of PYGB

Synonyms Polyclonal PYGB antibody, Anti-PYGB antibody, Phosphorylase Glycogen; Brain antibody, MGC9213 antibody
Specificity PYGB antibody was raised against the N terminal of PYGB
Cross Reactivity Human,Mouse
Applications WB
Immunogen PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
Assay Information PYGB Blocking Peptide, catalog no. 33R-1085, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody


Western Blot analysis using PYGB antibody (70R-2604)

PYGB antibody (70R-2604) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PYGB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PYGB antibody (70R-2604) | PYGB antibody (70R-2604) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors