R3HDM2 Blocking Peptide (33R-7740)
A synthetic peptide for use as a blocking control in assays to test for specificity of R3HDM2 antibody, catalog no. 70R-4232
Overview
Overview
| Synonyms | R3HDM2 control peptide, R3HDM2 antibody Blocking Peptide, Anti-R3HDM2 Blocking Peptide, R3H Domain Containing 2 Blocking Peptide, KIAA1002 Blocking Peptide, PR01365 Blocking Peptide, R3HDM2, RHDM2-3, RHDM2 3, RHDM2-3 Blocking Peptide, RHDM2 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG |
|---|---|
| Molecular Weight | 68 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product