R3HDM2 Blocking Peptide (33R-7740)

A synthetic peptide for use as a blocking control in assays to test for specificity of R3HDM2 antibody, catalog no. 70R-4232

Synonyms R3HDM2 control peptide, R3HDM2 antibody Blocking Peptide, Anti-R3HDM2 Blocking Peptide, R3H Domain Containing 2 Blocking Peptide, KIAA1002 Blocking Peptide, PR01365 Blocking Peptide, R3HDM2, RHDM2-3, RHDM2 3, RHDM2-3 Blocking Peptide, RHDM2 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG
Molecular Weight 68 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors