RAB15 Blocking Peptide (33R-8810)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB15 antibody, catalog no. 70R-5831
Overview
Overview
| Synonyms | RAB15 control peptide, RAB15 antibody Blocking Peptide, Anti-RAB15 Blocking Peptide, Rab15 Member Ras Onocogene Family Blocking Peptide, RAB15, RAB-15, RAB 15, RAB-15 Blocking Peptide, RAB 15 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product