RAB15 Blocking Peptide (33R-8810)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB15 antibody, catalog no. 70R-5831

Synonyms RAB15 control peptide, RAB15 antibody Blocking Peptide, Anti-RAB15 Blocking Peptide, Rab15 Member Ras Onocogene Family Blocking Peptide, RAB15, RAB-15, RAB 15, RAB-15 Blocking Peptide, RAB 15 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors