RAB18 antibody (70R-5796)

Rabbit polyclonal RAB18 antibody raised against the C terminal of RAB18

Synonyms Polyclonal RAB18 antibody, Anti-RAB18 antibody, RAB18, RAB-18 antibody, Rab18 Member Ras Oncogene Family antibody, RAB 18, RAB 18 antibody, RAB18LI1 antibody, RAB-18
Specificity RAB18 antibody was raised against the C terminal of RAB18
Cross Reactivity Human,Mouse
Applications WB
Immunogen RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG
Assay Information RAB18 Blocking Peptide, catalog no. 33R-4939, is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody

Images

Western Blot analysis using RAB18 antibody (70R-5796)

RAB18 antibody (70R-5796) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB18 belongs to the small GTPase superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB18 antibody (70R-5796) | RAB18 antibody (70R-5796) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors