RAB23 antibody (70R-5787)

Rabbit polyclonal RAB23 antibody raised against the N terminal of RAB23

Synonyms Polyclonal RAB23 antibody, Anti-RAB23 antibody, RAB23, DKFZp781H0695 antibody, RAB 23, HSPC137 antibody, MGC8900 antibody, RAB-23, RAB 23 antibody, RAB-23 antibody, Rab23 Member Ras Oncogene Family antibody
Specificity RAB23 antibody was raised against the N terminal of RAB23
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB23 antibody was raised using the N terminal of RAB23 corresponding to a region with amino acids TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA
Assay Information RAB23 Blocking Peptide, catalog no. 33R-9136, is also available for use as a blocking control in assays to test for specificity of this RAB23 antibody


Western blot analysis using RAB23 antibody (70R-5787)

Recommended RAB23 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RAB23 antibody (70R-5787) | Recommended RAB23 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors