RAB2B Blocking Peptide (33R-6895)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2B antibody, catalog no. 70R-10148

Synonyms RAB2B control peptide, RAB2B antibody Blocking Peptide, Anti-RAB2B Blocking Peptide, RAB2B, member RAS oncogene family Blocking Peptide, FLJ14824 Blocking Peptide, RAB2B, RABB-2, RABB 2, RABB-2 Blocking Peptide, RABB 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors