RAB2B Blocking Peptide (33R-6895)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2B antibody, catalog no. 70R-10148
Overview
Overview
| Synonyms | RAB2B control peptide, RAB2B antibody Blocking Peptide, Anti-RAB2B Blocking Peptide, RAB2B, member RAS oncogene family Blocking Peptide, FLJ14824 Blocking Peptide, RAB2B, RABB-2, RABB 2, RABB-2 Blocking Peptide, RABB 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product