RAB38 Blocking Peptide (33R-6318)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB38 antibody, catalog no. 70R-5865

Synonyms RAB38 control peptide, RAB38 antibody Blocking Peptide, Anti-RAB38 Blocking Peptide, Rab38 Member Ras Oncogene Family Blocking Peptide, NY-MEL-1 Blocking Peptide, rrGTPbp Blocking Peptide, RAB38, RAB-38, RAB 38, RAB-38 Blocking Peptide, RAB 38 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors