RAB38 Blocking Peptide (33R-6318)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB38 antibody, catalog no. 70R-5865
Overview
Overview
| Synonyms | RAB38 control peptide, RAB38 antibody Blocking Peptide, Anti-RAB38 Blocking Peptide, Rab38 Member Ras Oncogene Family Blocking Peptide, NY-MEL-1 Blocking Peptide, rrGTPbp Blocking Peptide, RAB38, RAB-38, RAB 38, RAB-38 Blocking Peptide, RAB 38 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product