RAB39 antibody (70R-4499)

Rabbit polyclonal RAB39 antibody raised against the N terminal of RAB39

Synonyms Polyclonal RAB39 antibody, Anti-RAB39 antibody, RAB 39, RAB-39, RAB-39 antibody, Rab39 Member Ras Oncogene Family antibody, RAB39, RAB 39 antibody
Specificity RAB39 antibody was raised against the N terminal of RAB39
Cross Reactivity Human
Applications WB
Immunogen RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF
Assay Information RAB39 Blocking Peptide, catalog no. 33R-5969, is also available for use as a blocking control in assays to test for specificity of this RAB39 antibody


Western Blot analysis using RAB39 antibody (70R-4499)

RAB39 antibody (70R-4499) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB39 may be involved in vesicular trafficking.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB39 antibody (70R-4499) | RAB39 antibody (70R-4499) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors