RAB40A Blocking Peptide (33R-8107)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB40A antibody, catalog no. 70R-5855
Overview
Overview
| Synonyms | RAB40A control peptide, RAB40A antibody Blocking Peptide, Anti-RAB40A Blocking Peptide, Rab40A Member Ras Oncogene Family Blocking Peptide, MGC142061 Blocking Peptide, RAR2A Blocking Peptide, Rar-2 Blocking Peptide, RAB40A, RABA-40, RABA 40, RABA-40 Blocking Peptide, RABA 40 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product