RAB40A Blocking Peptide (33R-8107)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB40A antibody, catalog no. 70R-5855

Synonyms RAB40A control peptide, RAB40A antibody Blocking Peptide, Anti-RAB40A Blocking Peptide, Rab40A Member Ras Oncogene Family Blocking Peptide, MGC142061 Blocking Peptide, RAR2A Blocking Peptide, Rar-2 Blocking Peptide, RAB40A, RABA-40, RABA 40, RABA-40 Blocking Peptide, RABA 40 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Molecular Weight 31 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors