RAB5A Blocking Peptide (33R-8417)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5861

Synonyms RAB5A control peptide, RAB5A antibody Blocking Peptide, Anti-RAB5A Blocking Peptide, Rab5A Member Ras Oncogene Family Blocking Peptide, RAB5 Blocking Peptide, RAB5A, RABA-5, RABA 5, RABA-5 Blocking Peptide, RABA 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB5A is required for the fusion of plasma membranes and early endosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors