RAB5A Blocking Peptide (33R-8417)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5861
Overview
Overview
| Synonyms | RAB5A control peptide, RAB5A antibody Blocking Peptide, Anti-RAB5A Blocking Peptide, Rab5A Member Ras Oncogene Family Blocking Peptide, RAB5 Blocking Peptide, RAB5A, RABA-5, RABA 5, RABA-5 Blocking Peptide, RABA 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS |
|---|---|
| Molecular Weight | 24 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB5A is required for the fusion of plasma membranes and early endosomes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product