RAB5B antibody (70R-5873)

Rabbit polyclonal RAB5B antibody raised against the N terminal of RAB5B

Synonyms Polyclonal RAB5B antibody, Anti-RAB5B antibody, RABB-5 antibody, RAB5B, RABB 5 antibody, RABB-5, RABB 5, Rab5B Member Ras Oncogene Family antibody
Specificity RAB5B antibody was raised against the N terminal of RAB5B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
Assay Information RAB5B Blocking Peptide, catalog no. 33R-6565, is also available for use as a blocking control in assays to test for specificity of this RAB5B antibody


Western Blot analysis using RAB5B antibody (70R-5873)

RAB5B antibody (70R-5873) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB5B antibody (70R-5873) | RAB5B antibody (70R-5873) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors