RAB9A Blocking Peptide (33R-8619)
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8643
Overview
Overview
| Synonyms | RAB9A control peptide, RAB9A antibody Blocking Peptide, Anti-RAB9A Blocking Peptide, RAB9A, member RAS oncogene family Blocking Peptide, RAB9 Blocking Peptide, RAB9A, RABA-9, RABA 9, RABA-9 Blocking Peptide, RABA 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RAB9A is involved in the transport of proteins between the endosomes and the trans Golgi network. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product