RAB9A Blocking Peptide (33R-8619)

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8643

Synonyms RAB9A control peptide, RAB9A antibody Blocking Peptide, Anti-RAB9A Blocking Peptide, RAB9A, member RAS oncogene family Blocking Peptide, RAB9 Blocking Peptide, RAB9A, RABA-9, RABA 9, RABA-9 Blocking Peptide, RABA 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB9A is involved in the transport of proteins between the endosomes and the trans Golgi network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors