RABEPK Blocking Peptide (33R-8341)
A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4503
Overview
Overview
| Synonyms | RABEPK control peptide, RABEPK antibody Blocking Peptide, Anti-RABEPK Blocking Peptide, Rab9 Effector Protein With Kelch Motifs Blocking Peptide, DKFZp686P1077 Blocking Peptide, RAB9P40 Blocking Peptide, bA65N13.1 Blocking Peptide, p40 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL |
|---|---|
| Molecular Weight | 40 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product