RABEPK Blocking Peptide (33R-8341)

A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4503

Synonyms RABEPK control peptide, RABEPK antibody Blocking Peptide, Anti-RABEPK Blocking Peptide, Rab9 Effector Protein With Kelch Motifs Blocking Peptide, DKFZp686P1077 Blocking Peptide, RAB9P40 Blocking Peptide, bA65N13.1 Blocking Peptide, p40 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors