RABGEF1 Blocking Peptide (33R-6460)
A synthetic peptide for use as a blocking control in assays to test for specificity of RABGEF1 antibody, catalog no. 70R-3156
Overview
Overview
| Synonyms | RABGEF1 control peptide, RABGEF1 antibody Blocking Peptide, Anti-RABGEF1 Blocking Peptide, Rab RNA guanine Nucleotide Exchange Factor Blocking Peptide, Gef 1 Blocking Peptide, FLJ32302 Blocking Peptide, RABEX5 Blocking Peptide, rabex-5 Blocking Peptide, RABGEF1, RABGEF-1, RABGEF 1, RABGEF-1 Blocking Peptide, RABGEF 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ |
|---|---|
| Molecular Weight | 57 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product