RABGEF1 Blocking Peptide (33R-6460)

A synthetic peptide for use as a blocking control in assays to test for specificity of RABGEF1 antibody, catalog no. 70R-3156

Synonyms RABGEF1 control peptide, RABGEF1 antibody Blocking Peptide, Anti-RABGEF1 Blocking Peptide, Rab RNA guanine Nucleotide Exchange Factor Blocking Peptide, Gef 1 Blocking Peptide, FLJ32302 Blocking Peptide, RABEX5 Blocking Peptide, rabex-5 Blocking Peptide, RABGEF1, RABGEF-1, RABGEF 1, RABGEF-1 Blocking Peptide, RABGEF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
Molecular Weight 57 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors