RABL4 antibody (70R-5863)

Rabbit polyclonal RABL4 antibody raised against the C terminal of RABL4

Synonyms Polyclonal RABL4 antibody, Anti-RABL4 antibody, RAYL antibody, RABL 4 antibody, RABL 4, RABL4, Rab Member Of Ras Oncogene Family-Like 4 antibody, RABL-4 antibody, RABL-4
Specificity RABL4 antibody was raised against the C terminal of RABL4
Cross Reactivity Human
Applications WB
Immunogen RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Assay Information RABL4 Blocking Peptide, catalog no. 33R-7831, is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody


Western Blot analysis using RABL4 antibody (70R-5863)

RABL4 antibody (70R-5863) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RABL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RABL4 antibody (70R-5863) | RABL4 antibody (70R-5863) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors